PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.1040s0029.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ARF
Protein Properties Length: 575aa    MW: 64922 Da    PI: 7.8236
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.1040s0029.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.13e-22116217199
                          EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                          f kvlt sd++++g +++p+ +a+++     ++++  +++ + +d++ ++W++k+++r++++r++lt+GW+ F  a++L +gD++vF   
  Bostr.1040s0029.1.p 116 FTKVLTASDTSTQGGFSVPRIHATKClppldMSIPVPTQEFISKDLHVNEWRFKHSFRGTPKRHLLTTGWSAFITAKKLVAGDVFVFL-- 203
                          89****************************9666667779999*********************************************.. PP

                          SSSEE..EEEEE-S CS
                   B3  86 grsefelvvkvfrk 99 
                          + +++el+v+++r+
  Bostr.1040s0029.1.p 204 RGETGELRVGIRRA 217
                          449999*****996 PP

2Auxin_resp95.67.6e-32242321183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha+ ++++F+vvY+ r  ts+Fvv+++k+++a+++k+ vG+Rf m+fe+ed+serr++Gt++gv+++++ +W++S+WrsL+
  Bostr.1040s0029.1.p 242 AMHAFGNQCMFTVVYKAR--TSQFVVSYDKFLDAMNNKFNVGSRFTMRFEGEDFSERRYAGTIIGVNNFSS-HWKDSEWRSLQ 321
                          78999**********988..59**********************************************888.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-35106228IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.7E-30111242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.56E-19115216No hitNo description
PROSITE profilePS5086311.66116218IPR003340B3 DNA binding domain
PfamPF023623.5E-20116217IPR003340B3 DNA binding domain
SMARTSM010193.0E-19116218IPR003340B3 DNA binding domain
PfamPF065074.3E-29242321IPR010525Auxin response factor
PfamPF023091.6E-13470563IPR033389AUX/IAA domain
SuperFamilySSF542775.4E-14477555No hitNo description
PROSITE profilePS5174527.739479560IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MESGNIVDAH PQKLLGIIDG TKSYMYEQLW KLCAGPLCDL PKLGEKVYYF PKGHIEFVKT  60
STREDLNETQ PIFDLPSKPR CRVIAIHLKI GLMPDTREVI IPTQNDNNYK PIVNSFTKVL  120
TASDTSTQGG FSVPRIHATK CLPPLDMSIP VPTQEFISKD LHVNEWRFKH SFRGTPKRHL  180
LTTGWSAFIT AKKLVAGDVF VFLRGETGEL RVGIRRAGHQ EGNIPSSLVS LESMRHGVIA  240
SAMHAFGNQC MFTVVYKART SQFVVSYDKF LDAMNNKFNV GSRFTMRFEG EDFSERRYAG  300
TIIGVNNFSS HWKDSEWRSL QVQWDELASF QRPDKVSPWE IEHLTPSSNV LQSSLLKNKR  360
SRHVNEIGLT SSHLLPPILT QGREIGQPTN QVDNRDAIED ANDQMVTPIK ENITTVAGAS  420
CRLFGVSLAT PSEIKDPMEP NDSYQISEIS KNYQEKNFGL TQTLTSPKEI QSKQFNPTRS  480
YTKVQMQGVT IGRALDLSVL NGYDQLIQEL EKLFDLKGLL RTRNQWEIVY TDNEGDMMLV  540
GDDPWPEFCS MVKKIFICSK EEVKNLKSGN SLSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1192535119362Auxin response factor 1
4ldw_A1e-1192535119362Auxin response factor 1
4ldv_A1e-1192535119362Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478873.10.0PREDICTED: putative auxin response factor 14 isoform X1
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLD7L9F70.0D7L9F7_ARALL; Auxin response factor
STRINGAT1G35540.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14